Scaffold Ga0119967_10054391

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119967_10054391

Scaffold Ga0119967_10054391

Overview

Basic Information
Taxon OID	3300014060 Open in IMG/M
Scaffold ID	Ga0119967_10054391 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Berkeley
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2661
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Geyser, Utah, Usa

Source Dataset Sampling Location
Location Name	USA: near Green River, Utah
Coordinates	Lat. (^o)	38.938	Long. (^o)	-110.08	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024479	Metagenome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119967_100543918	F024479	N/A	MCETHKSIVLWWISPDEKEKLLAFETKKKEKYKGLKVYDGTTMEGL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.