| Basic Information | |
|---|---|
| Taxon OID | 3300014059 Open in IMG/M |
| Scaffold ID | Ga0119868_1005564 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Membrane foulants |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Tongji University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4466 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Communities From Shanghai, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Quyang, Shanghai | |||||||
| Coordinates | Lat. (o) | 31.3 | Long. (o) | 121.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024972 | Metagenome / Metatranscriptome | 203 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119868_100556411 | F024972 | GAGG | MKITKVTKTYFETEGERVYFFEPLDEEMTLAELQELMDEHEKFVLETIQKMKKEKL* |
| ⦗Top⦘ |