Scaffold Ga0120384_1284530

Overview

Basic Information

• Taxon OID: 3300014057
• Scaffold ID: Ga0120384_1284530
• Source Dataset Name: Sheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1208
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Missouri
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 41.314168
  • Long. (^o): -105.584589

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020828	Metagenome / Metatranscriptome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120384_12845301	F020828	N/A	VSDAAAFYRAEEGSSTEKVFWSQYAEAGHAVPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPRLEVIKRSICIEGPRAKVHWGNMDAEKLVKDGPPEGKLHRVPEKYYDGVMKHACLVANECSKDIIFE*