Scaffold Ga0117790_1054039

Overview

Basic Information

• Taxon OID: 3300014042
• Scaffold ID: Ga0117790_1054039
• Source Dataset Name: Epidermal mucus viral and microbial communities from European eel in Spain - Ebro delta (0.22 um filter)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Valencia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 686
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus → Epidermal Mucus Viral And Microbial Communities From European Eel In Spain

Source Dataset Sampling Location

• Location Name: Spain: Alfacada pond
• Coordinates
  • Lat. (^o): 40.647955
  • Long. (^o): -0.738702

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066593	Metagenome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117790_10540392	F066593	N/A	MKIEVNFVFRDTQIDPIYERLGLEIDAEVEVQERGVLELDEVVGASEFYELTQIYLRSSHIFYIDLPFDEFKILWMS*