NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116707_1062990

Scaffold Ga0116707_1062990


Overview

Basic Information
Taxon OID3300014041 Open in IMG/M
Scaffold IDGa0116707_1062990 Open in IMG/M
Source Dataset NameCoral microbial communities from a home aquarium in Belgium - PD-TF-control B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Mons
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)534
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France

Source Dataset Sampling Location
Location NameBelgium: Mons, Walloon Region
CoordinatesLat. (o)50.45Long. (o)3.93Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061437Metagenome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0116707_10629902F061437N/APLQYDLRSSAAKDNSILHAAAARSNLDAAITLRSAETDLQNTIELHATASAIAAPKPDLDAKAEKRRF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.