Scaffold Ga0116707_1024772

Overview

Basic Information

• Taxon OID: 3300014041
• Scaffold ID: Ga0116707_1024772
• Source Dataset Name: Coral microbial communities from a home aquarium in Belgium - PD-TF-control B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Mons
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 683
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France

Source Dataset Sampling Location

• Location Name: Belgium: Mons, Walloon Region
• Coordinates
  • Lat. (^o): 50.45
  • Long. (^o): 3.93

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028997	Metagenome / Metatranscriptome	189	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116707_10247723	F028997	GGA	MIEGSLEVKLPTIWTDEKQSRAEAERRGRLEERRSEEK