| Basic Information | |
|---|---|
| Taxon OID | 3300014030 Open in IMG/M |
| Scaffold ID | Ga0116816_1024108 Open in IMG/M |
| Source Dataset Name | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_Metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 705 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011401 | Metagenome / Metatranscriptome | 291 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116816_10241082 | F011401 | N/A | PITVKGLGDALYSALRDKEGDSITLELFQPKEIIRGVIEQITYPVISNNNVGSDTTFAIITVRGTRQTTLTDVTSIHVPGIAAFGIMRYGA* |
| ⦗Top⦘ |