Basic Information | |
---|---|
Taxon OID | 3300014028 Open in IMG/M |
Scaffold ID | Ga0117810_1050196 Open in IMG/M |
Source Dataset Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 32 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chalmers University of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 676 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101355 | Metagenome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117810_10501961 | F101355 | GGA | MIEPPFQHGIADMAFWFIQWYLPSAQPPQPKGTGAVFSYVLPRCSYFFKIFVTEMSIFICMHKCLAQTGRLRGSSCHIVVAAKRACACTLLWISDHFCKKLLPYVLFFFFKIYLKKIDFFQNIA* |
⦗Top⦘ |