| Basic Information | |
|---|---|
| Taxon OID | 3300014028 Open in IMG/M |
| Scaffold ID | Ga0117810_1022141 Open in IMG/M |
| Source Dataset Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 32 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chalmers University of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1106 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium LM158 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074899 | Metagenome / Metatranscriptome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117810_10221413 | F074899 | N/A | MSGRKQWNKQAATSSFLDKKTPQSLIQQGLEGSTVVGKDEVGSS |
| ⦗Top⦘ |