| Basic Information | |
|---|---|
| Taxon OID | 3300014023 Open in IMG/M |
| Scaffold ID | Ga0119891_102734 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_AS_meta |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Nanjing University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1072 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Nanjing | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032274 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119891_1027341 | F032274 | N/A | VAGVVSLLKRELGLDKTMQVSFDFTEQTEIVKREKRKPFEARQDWQRAPKIIVTEEYIALDKKLEPIEEELFELIKKMPLAIEKKIKGKICVIPSGLKTDEELICRVRELRKQASKIGKELDALFFKTNPEWAKFYE |
| ⦗Top⦘ |