Basic Information | |
---|---|
Taxon OID | 3300013957 Open in IMG/M |
Scaffold ID | Ga0119892_114413 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_EW_meta |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Nanjing University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 544 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | China: Nanjing | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103024 | Metagenome / Metatranscriptome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119892_1144131 | F103024 | N/A | ETKQMRTSRKLTHSLLALFALVVMSSFAMAADPGLLVPPTSEVSDQKAGSLLIYNVYTSGATSGNTENTRINITNTSVTSAAFVHLYFVSAGCGIADSYICLTATQTASFLASDVDPGIKGYIVGVAVDGVLGCPVAFNWLIGDEYVKFASGHAANLGALAFAALYDGRLPGCDANSVTA |
⦗Top⦘ |