Scaffold Ga0116699_1052388

Overview

Basic Information

• Taxon OID: 3300013948
• Scaffold ID: Ga0116699_1052388
• Source Dataset Name: Coral microbial communities from a home aquarium in Belgium - AM-T0-control A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Mons
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France

Source Dataset Sampling Location

• Location Name: Belgium: Mons, Walloon Region
• Coordinates
  • Lat. (^o): 50.45
  • Long. (^o): 3.93

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017439	Metagenome / Metatranscriptome	240	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116699_10523882	F017439	GAG	MNATMQYIPEVLFILLHNVALAFGFVDKILKCDHSNESYWAVISCGAVYYAEQGDSNFWVCG*