Scaffold Ga0116699_1026501

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116699_1026501

Scaffold Ga0116699_1026501

Overview

Basic Information
Taxon OID	3300013948 Open in IMG/M
Scaffold ID	Ga0116699_1026501 Open in IMG/M
Source Dataset Name	Coral microbial communities from a home aquarium in Belgium - AM-T0-control A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Mons
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	780
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral Tissue → Coral Microbial Communities From Home Aquarium In Belgium And Reunion Island, France

Source Dataset Sampling Location
Location Name	Belgium: Mons, Walloon Region
Coordinates	Lat. (^o)	50.45	Long. (^o)	3.93	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022326	Metagenome / Metatranscriptome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116699_10265011	F022326	GAGG	MTVEKPKPKPKQLLRPITTGAGGAMNQSQFLAITSNSLEVREKSRVHGAVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.