Basic Information | |
---|---|
Taxon OID | 3300013946 Open in IMG/M |
Scaffold ID | Ga0117818_1018803 Open in IMG/M |
Source Dataset Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 314 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chalmers University of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1120 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | 0 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092227 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117818_10188032 | F092227 | AGGAG | MNEQKHKRWLRIGCLVLAGVFALSLLSSVIMMLL* |
⦗Top⦘ |