Scaffold Ga0117818_1000778

Overview

Basic Information

• Taxon OID: 3300013946
• Scaffold ID: Ga0117818_1000778
• Source Dataset Name: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 314
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chalmers University of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8493
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location

• Coordinates
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087334	Metagenome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117818_10007787	F087334	N/A	MASRYPFVGAAAHLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLYRAASLFEYRENHQ*