| Basic Information | |
|---|---|
| Taxon OID | 3300013941 Open in IMG/M |
| Scaffold ID | Ga0117792_1005491 Open in IMG/M |
| Source Dataset Name | Epidermal mucus viral and microbial communities from European eel in Spain - water from Alfacada pond (Ebro delta) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Valencia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1639 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fish → Skin → Epidermal Mucus → Unclassified → Epidermal Mucus → Epidermal Mucus Viral And Microbial Communities From European Eel In Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Alfacada pond | |||||||
| Coordinates | Lat. (o) | 40.647955 | Long. (o) | -0.738702 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001588 | Metagenome / Metatranscriptome | 667 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117792_10054912 | F001588 | GAGG | MQNTNYVFLNAADAAIVVTVNNTVVATDVQTADALVQVFLTHNINVLTDTIMCSSSIDFAEEEGFATDSCAHNIIDAALDALS* |
| ⦗Top⦘ |