Scaffold Ga0117807_1001830

Overview

Basic Information

• Taxon OID: 3300013940
• Scaffold ID: Ga0117807_1001830
• Source Dataset Name: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 252
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chalmers University of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6700
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (77.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Subdoligranulum → Subdoligranulum variabile (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047126	Metagenome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117807_10018307	F047126	N/A	VYLKTKKMTNISQTQAGFKSKSLGILCGFQGFLTQNPAALVETDDIFDVSDTSYGFSGLNTLRAAGVPNPPPPFAQRFIACFCSQTAAASQSKSAYILSSLESPCILCSLLRYFHILSKKLQKTC*