Basic Information | |
---|---|
Taxon OID | 3300013940 Open in IMG/M |
Scaffold ID | Ga0117807_1000408 Open in IMG/M |
Source Dataset Name | Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 252 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chalmers University of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 18669 |
Total Scaffold Genes | 17 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (58.82%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087213 | Metagenome | 110 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117807_10004085 | F087213 | AGG | MKKFSSVLLAVLLIFSCWTAATAESIDAVSGAPLDNDIEIVYKEHFDDMVTHYADELTEAELLVSADVYDAIGMIRFDSEDSLAARQRIYGIASADDLHAILTGYFDPNDAAYTADTALDARLQAILAACGLNPADYDISVIRNLSGMPEPITGTNWYCTLIRKGIEVAEDETNPYDMVIVLYGDEMTVGAFVLNPEV* |
⦗Top⦘ |