Scaffold Ga0117797_1026997

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117797_1026997

Scaffold Ga0117797_1026997

Overview

Basic Information
Taxon OID	3300013938 Open in IMG/M
Scaffold ID	Ga0117797_1026997 Open in IMG/M
Source Dataset Name	Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 235
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chalmers University of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	750
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044554	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117797_10269971	F044554	N/A	YVLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRTNFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFNSHRYCFSAFLVL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.