Scaffold Ga0117820_1000015

Overview

Basic Information

• Taxon OID: 3300013900
• Scaffold ID: Ga0117820_1000015
• Source Dataset Name: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 250
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chalmers University of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 62494
• Total Scaffold Genes: 68
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 38 (55.88%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location

• Coordinates
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082887	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117820_10000153	F082887	AGGGGG	MEKIKAIAKYAINILAIISALIAGINAVDGITIPYAVQIIQVIAVIQGVISTYLLGQKVVRNRGENRENNRNKPKV*