NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181464_1003247

Scaffold Ga0181464_1003247


Overview

Basic Information
Taxon OID3300013873 Open in IMG/M
Scaffold IDGa0181464_1003247 Open in IMG/M
Source Dataset NameClean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2-11 gowning area SPAdes reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7767
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa

Source Dataset Sampling Location
Location NameUSA: Jet Propulsion Laboratory, Pasadena, California
CoordinatesLat. (o)34.1Long. (o)-118.1Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017428Metagenome240Y

Sequences

Protein IDFamilyRBSSequence
Ga0181464_10032471F017428GGAVDIEGASTLKNFIVIEIVDNRNPYPTLLGIEWATNINGMINLKKSKVIFEKKSMRVVVPLDLIEGSRYTKLVRDYDNNDELDYIYKIIAREQD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.