| Basic Information | |
|---|---|
| Taxon OID | 3300013870 Open in IMG/M |
| Scaffold ID | Ga0181465_103820 Open in IMG/M |
| Source Dataset Name | Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In3-11 gowning area SPAdes reassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4525 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Jet Propulsion Laboratory, Pasadena, California | |||||||
| Coordinates | Lat. (o) | 34.1 | Long. (o) | -118.1 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038985 | Metagenome / Metatranscriptome | 164 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181465_1038201 | F038985 | N/A | MINVGPMFPKKCHLGPQNDSESLGPEKLPQIVNCATNKETEELKETMVGVQVE* |
| ⦗Top⦘ |