NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119898_1041728

Scaffold Ga0119898_1041728


Overview

Basic Information
Taxon OID3300013800 Open in IMG/M
Scaffold IDGa0119898_1041728 Open in IMG/M
Source Dataset NameWastewater microbial communities from municipal sewage treatment plant in Nanjing, China - ZZ_EW_meta
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNanjing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)587
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Source Dataset Sampling Location
Location NameChina: Nanjing
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082381Metagenome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0119898_10417282F082381N/AMRKTNLDKIKQGGKRVGSGRKKADYQTKTIAFRVRLEWVEVIRSMVKAKVSELSQNSS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.