Scaffold Ga0119904_10225535

Overview

Basic Information

• Taxon OID: 3300013771
• Scaffold ID: Ga0119904_10225535
• Source Dataset Name: Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92206
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: California Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 660
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Source Dataset Sampling Location

• Location Name: Australia: Brisbane, Thorneside Wastewater Treatment Plant
• Coordinates
  • Lat. (^o): -27.485973
  • Long. (^o): 153.190699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104545	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119904_102255352	F104545	N/A	VRVGKDQPIRTCTAQHARRRIVGQQAGIDCDAATRAVRVSMVSGQPDVEPVDTILRSGGRRKTFRDALASRGRVRQRLEMAPVANPFRHAVIKVAAQAPDRERSRSGSSPRWQLGP*