Scaffold Ga0119887_1040311

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119887_1040311

Scaffold Ga0119887_1040311

Overview

Basic Information
Taxon OID	3300013769 Open in IMG/M
Scaffold ID	Ga0119887_1040311 Open in IMG/M
Source Dataset Name	Sewage treatment plant microbial communities from Vermont, USA - Sand_B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwich University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1362
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location Name	USA: Vermont
Coordinates	Lat. (^o)	43.727094	Long. (^o)	-72.425964	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081715	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119887_10403112	F081715	GGAGG	MDKTNDDLWLAFEALAKTYPHDHGVRMTADLARWLLEERQRLQLAVPPIIEKVVHMVTIAPDAPAALPLRETPTAGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.