| Basic Information | |
|---|---|
| Taxon OID | 3300013768 Open in IMG/M |
| Scaffold ID | Ga0120155_1055145 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1172 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .65 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024932 | Metagenome / Metatranscriptome | 204 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120155_10551452 | F024932 | N/A | YVAFMRCLLAITIALTVALQPAPVAAGSSWGGSGDGDPPSWCTKFSDMWTATIVTNDPLVGTNPERDTFYGFHPNPGYDDWYGYFYGDFRGTPGDSSGWVRLLHENYPRHYSWNFATNGWAVHGHVKQYIAYYNWTFGGQCGLGAYGNNAPPPYMADQYGYPVVDIYVDAVPPFDPKPYVAAITSSSVAFTWDPVADRGDGAGRDYFISGLDHYVSWLTVGDRSGQLQLATTSTPRTISLAGMTPGETVCVHVEAVDRVKNPRNQKKSIKNSMPGIDTV* |
| ⦗Top⦘ |