Scaffold Ga0117777_1028446

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117777_1028446

Scaffold Ga0117777_1028446

Overview

Basic Information
Taxon OID	3300013755 Open in IMG/M
Scaffold ID	Ga0117777_1028446 Open in IMG/M
Source Dataset Name	Crude oil microbial communities from oil reservoirs in Daqing, China - Crude oil from DQ
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Peking University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1163
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Crude Oil → Crude Oil Microbial Communities From Oil Reservoirs In China

Source Dataset Sampling Location
Location Name	China: Daqing
Coordinates	Lat. (^o)	45.5	Long. (^o)	124.15	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071210	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117777_10284462	F071210	GGGGG	MKEKRWLGTQKYELHCFYCGGFHMTGNCPQIVKEMNGWKYDRSCPETGHIKIVPNGDEYPTVLAFNGYHYRVVGLWGVPGKLLWLELQRFCGDTIVAATFCPDELMEMDLGMSDDEQLSAWLGGLPFLSVSPPEFNGSEAEADVKTTTGESL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.