| Basic Information | |
|---|---|
| Taxon OID | 3300013755 Open in IMG/M |
| Scaffold ID | Ga0117777_1028446 Open in IMG/M |
| Source Dataset Name | Crude oil microbial communities from oil reservoirs in Daqing, China - Crude oil from DQ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Peking University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1163 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Crude Oil → Crude Oil Microbial Communities From Oil Reservoirs In China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | China: Daqing | |||||||
| Coordinates | Lat. (o) | 45.5 | Long. (o) | 124.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071210 | Metagenome / Metatranscriptome | 122 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117777_10284462 | F071210 | GGGGG | MKEKRWLGTQKYELHCFYCGGFHMTGNCPQIVKEMNGWKYDRSCPETGHIKIVPNGDEYPTVLAFNGYHYRVVGLWGVPGKLLWLELQRFCGDTIVAATFCPDELMEMDLGMSDDEQLSAWLGGLPFLSVSPPEFNGSEAEADVKTTTGESL* |
| ⦗Top⦘ |