Scaffold Ga0117817_1002600

Overview

Basic Information

• Taxon OID: 3300013752
• Scaffold ID: Ga0117817_1002600
• Source Dataset Name: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 288
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chalmers University of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5473
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location

• Coordinates
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068811	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117817_10026005	F068811	AGGA	MDQDGSEHNICSNREGLCPGKEQHGASGWKKIFQHGKEPLRNKDSISQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRIK*