| Basic Information | |
|---|---|
| Taxon OID | 3300013556 Open in IMG/M |
| Scaffold ID | Ga0119859_10021 Open in IMG/M |
| Source Dataset Name | Assembled human viral communities from clinical and cell-culture passaged samples from San Francisco, USA - NIBSC_BSRI |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Blood Systems Research Institute (BSRI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3354 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Synthesis → Unclassified → Unclassified → Unclassified → Assembled Human → Assembled Human Viral Communities From Clinical And Cell-Culture Passaged Samples From San Francisco, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Francisco | |||||||
| Coordinates | Lat. (o) | 37.77 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089592 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119859_100213 | F089592 | AGG | MKEILKSRKVLAEVNGFNIMSDTLYEVVGKHDGSAPQAFQDANIAKAPFPENATHVCCPWDDFSKAYNTGFYPRSRCYNGLDKNEIDRLVKQRVDNIMKPFEEMSQMDLSQTNLEFWDDAKDKIFMGKVYNTANTVDLFYLYLAVFSGMLTPQEMDGDPVFMNSMFCFVEKDNMKDFVQQREINKMNISYKFISALKKGGDDRQAVIDLLLYIGIVTRPDFTEDEYYTGSLSNWMNEKKTNVDYLLDIWDRSLEGDFKEVLEFYRIVNVLQRNGRINMTPSGLQYNGQIIGPDTRTSAEFLATKKDFINIKANVLDEYEEIISMSNIDDKSKTKKVKDIKKKDDVEEGDKVKEG* |
| ⦗Top⦘ |