 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300013556 Open in IMG/M |
| Scaffold ID | Ga0119859_10013 Open in IMG/M |
| Source Dataset Name | Assembled human viral communities from clinical and cell-culture passaged samples from San Francisco, USA - NIBSC_BSRI |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Blood Systems Research Institute (BSRI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7279 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (40.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Synthesis → Unclassified → Unclassified → Unclassified → Assembled Human → Assembled Human Viral Communities From Clinical And Cell-Culture Passaged Samples From San Francisco, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Francisco | |||||||
| Coordinates | Lat. (o) | 37.77 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076653 | Metagenome | 118 | N |
| F083451 | Metagenome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119859_1001314 | F083451 | GAG | MNVNLINKINNFSNVDKNEREKQVLDLLMSRKDIRKLVEKSNECYSKMDFVGAMRYRQEIKDIVDRESKIMLTKSESLVSLMNNADNEYKFNMLVWLHSMMCMADVFNGILEDFKDGVRKANGNSKFVKFDNLDRLMTECKKEIDYLMKGTSKSFQISFAVRSDELREMIENMVGDNIREGYDIFKEEAEMVNETDRSKIEEFNKKLDHD* |
| Ga0119859_100135 | F076653 | AGG | MTIRDKYFGWKDIFFDRFVHCCNEKSDQPQGSNIPLAKINFDNKTGYVEDGTINIAELLQYLWINNKVYGCEYAPIDISSVLQTLIRLTENAKHMFEDQPGIYDMIPYRGFFLRDDFSSGKDYSLDLDKIVSGMGGWYGEDEDPCYSMFVSQDQIWNLNPILKVLADEGSILAKELGYDMNSYVSDNGYTIYNPYLSWINHYYHYCPTFNEDKLKPWDRVEDRKNKFKMTDKVKRGANNWYYSGGTISCVDSFLGKKYRKNLRTFIYRGIVLFLDRIWHTPLFEKMGVKMKYNAYYCYAATSGIWYSKGFKERLAKRFNRSLSGGGEPFGANLACMVCDRKDIDWEALRLWLDKYDDPTDKGMVNSPIQFMYLYLYYTFNK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |