NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119859_10009

Scaffold Ga0119859_10009


Overview

Basic Information
Taxon OID3300013556 Open in IMG/M
Scaffold IDGa0119859_10009 Open in IMG/M
Source Dataset NameAssembled human viral communities from clinical and cell-culture passaged samples from San Francisco, USA - NIBSC_BSRI
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBlood Systems Research Institute (BSRI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7954
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Synthesis → Unclassified → Unclassified → Unclassified → Assembled Human → Assembled Human Viral Communities From Clinical And Cell-Culture Passaged Samples From San Francisco, Usa

Source Dataset Sampling Location
Location NameUSA: San Francisco
CoordinatesLat. (o)37.77Long. (o)-122.44Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098313Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0119859_1000911F098313N/AMREMEFDFVIYPLKLIITVGLDYKTLCDRFENMEPEHEGKWGDEDDMDKEASFANLVRDRYDDDKFAILWNFSSDDDLIMRNICHESFHIAMSVCQFCNMSLGFKVGEDEHAAYIAGFAGHCVGEFINNKDMD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.