| Basic Information | |
|---|---|
| Taxon OID | 3300013556 Open in IMG/M |
| Scaffold ID | Ga0119859_10009 Open in IMG/M |
| Source Dataset Name | Assembled human viral communities from clinical and cell-culture passaged samples from San Francisco, USA - NIBSC_BSRI |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Blood Systems Research Institute (BSRI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7954 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (16.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Synthesis → Unclassified → Unclassified → Unclassified → Assembled Human → Assembled Human Viral Communities From Clinical And Cell-Culture Passaged Samples From San Francisco, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Francisco | |||||||
| Coordinates | Lat. (o) | 37.77 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098313 | Metagenome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119859_1000911 | F098313 | N/A | MREMEFDFVIYPLKLIITVGLDYKTLCDRFENMEPEHEGKWGDEDDMDKEASFANLVRDRYDDDKFAILWNFSSDDDLIMRNICHESFHIAMSVCQFCNMSLGFKVGEDEHAAYIAGFAGHCVGEFINNKDMD* |
| ⦗Top⦘ |