Basic Information | |
---|---|
Taxon OID | 3300013556 Open in IMG/M |
Scaffold ID | Ga0119859_10009 Open in IMG/M |
Source Dataset Name | Assembled human viral communities from clinical and cell-culture passaged samples from San Francisco, USA - NIBSC_BSRI |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Blood Systems Research Institute (BSRI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7954 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (16.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Lab Synthesis → Unclassified → Unclassified → Unclassified → Assembled Human → Assembled Human Viral Communities From Clinical And Cell-Culture Passaged Samples From San Francisco, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Francisco | |||||||
Coordinates | Lat. (o) | 37.77 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098313 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119859_1000911 | F098313 | N/A | MREMEFDFVIYPLKLIITVGLDYKTLCDRFENMEPEHEGKWGDEDDMDKEASFANLVRDRYDDDKFAILWNFSSDDDLIMRNICHESFHIAMSVCQFCNMSLGFKVGEDEHAAYIAGFAGHCVGEFINNKDMD* |
⦗Top⦘ |