Scaffold Ga0117825_16403

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117825_16403

Scaffold Ga0117825_16403

Overview

Basic Information
Taxon OID	3300013459 Open in IMG/M
Scaffold ID	Ga0117825_16403 Open in IMG/M
Source Dataset Name	Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-2A-St-MgMD-nonhuman
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	San Diego State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa

Source Dataset Sampling Location
Location Name	USA: San Diego
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026592	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117825_164032	F026592	N/A	GLIFSIRFFKLAGGEQHLCCLRTASPQGIAALASQGSVAPLTEQSDATFSVGQFSSADRE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.