NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0177922_10983924

Scaffold Ga0177922_10983924


Overview

Basic Information
Taxon OID3300013372 Open in IMG/M
Scaffold IDGa0177922_10983924 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)694
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.844722Long. (o)-79.573889Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014956Metagenome / Metatranscriptome258Y

Sequences

Protein IDFamilyRBSSequence
Ga0177922_109839242F014956AGCAGMNIHEFVINVTTTVCPSHIVEPVHLRKWWRQRGVGELEKYFVSGNAIHYNEEIDWKKISDHKKSLWYDSQNFQINMGNEYSKRTS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.