| Basic Information | |
|---|---|
| Taxon OID | 3300013372 Open in IMG/M |
| Scaffold ID | Ga0177922_10196470 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1538 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ontario, Canada | |||||||
| Coordinates | Lat. (o) | 42.844722 | Long. (o) | -79.573889 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004788 | Metagenome / Metatranscriptome | 423 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0177922_101964702 | F004788 | AGG | MMNALEVLIKQADEKVGQLKDYLAEGRAESFEEYKKLCGEVRGLLIMRGYTLDLKQTMENSDD* |
| ⦗Top⦘ |