| Basic Information | |
|---|---|
| Taxon OID | 3300013314 Open in IMG/M |
| Scaffold ID | Ga0175859_1073151 Open in IMG/M |
| Source Dataset Name | Moss microbial communities from three moss species from boreal forest in Fairbanks, Alaska, USA Reanalysis |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Colorado |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1404 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Moss Associated → Moss Microbial Communities From Three Moss Species From Boreal Forest In Fairbanks, Ak, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Fairbanks, AK | |||||||
| Coordinates | Lat. (o) | 64.8591667 | Long. (o) | -147.8247222 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026380 | Metagenome / Metatranscriptome | 198 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0175859_10731511 | F026380 | GGAGG | VTERAAAERIVRELHQARLNGDLAGMCSLFADDGRFEIAGASADKPIAIRAQGLAEFRPWLAMMTKVFRLSDYHLI |
| ⦗Top⦘ |