| Basic Information | |
|---|---|
| Taxon OID | 3300013313 Open in IMG/M |
| Scaffold ID | Ga0173629_10045589 Open in IMG/M |
| Source Dataset Name | Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Berlin Center for Genomics in Biodiversity Research (BeGenDiv) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 564 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baltic Sea | |||||||
| Coordinates | Lat. (o) | 57.32 | Long. (o) | 20.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028789 | Metagenome / Metatranscriptome | 190 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0173629_100455893 | F028789 | AGGAG | MTDTINTGNVTLIRENEDGSADYQFNFPPEALEALTRLGILTAIQARIEDAK |
| ⦗Top⦘ |