NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173629_10035476

Scaffold Ga0173629_10035476


Overview

Basic Information
Taxon OID3300013313 Open in IMG/M
Scaffold IDGa0173629_10035476 Open in IMG/M
Source Dataset NameMarine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs re-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBerlin Center for Genomics in Biodiversity Research (BeGenDiv)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)643
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.32Long. (o)20.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010769Metagenome / Metatranscriptome299Y

Sequences

Protein IDFamilyRBSSequence
Ga0173629_100354761F010769N/AFLGPDLGFVNIMVYNDADGSCNLSIQELAAVCSGAMFQTCLDFLESSEEPPASPQCDRIFLGPDLGFVNIMVYNDADGTCEISLQELQAVCSGAMFQTCLDFLESSEDAPQCESVFLGPDLGFVNIMVYNDADGSCEISMQELQAVCSGAMFQTCLDFLESSEDAPQCESVFLGPDIGFANIMTYNDADGSCETSLQELGAVCQQFVAECLAF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.