NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170791_10994301

Scaffold Ga0170791_10994301


Overview

Basic Information
Taxon OID3300013295 Open in IMG/M
Scaffold IDGa0170791_10994301 Open in IMG/M
Source Dataset Namenorthern Canada Lakes metatranscriptome co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2755
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049614Metagenome / Metatranscriptome146N

Sequences

Protein IDFamilyRBSSequence
Ga0170791_109943015F049614GGAMTNSRMKGKNGELDACRALEKLFPFKWERTAQRYGKGKADVEAQCEWKIHVEVKRRKTGYTYVYGRLASDNLIVSGSLLICRLSKLRTVMDDGVCLPNVAPRCAGLEDAMLQARTDARVGWLPIVLARQDDEEWLLAWREEVDTRLMEEVRTWLGDGDTKVA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.