Scaffold Ga0172517_104269

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172517_104269

Scaffold Ga0172517_104269

Overview

Basic Information
Taxon OID	3300013290 Open in IMG/M
Scaffold ID	Ga0172517_104269 Open in IMG/M
Source Dataset Name	Enriched microbial communities from a natural gas condensate-contaminated anoxic aquifer near Ft. Lupton, CO, USA ? 13C-labelled, 2 mo incubation
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Calgary
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1739
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Anoxic Aquifer → Stable Isotope And Metagenomic Profiling Of A Methanogenic Naphthalene-Degrading Enrichment Culture

Source Dataset Sampling Location
Location Name	South Platte Alluvial Aquifer near Denver, CO, USA
Coordinates	Lat. (^o)	40.3921	Long. (^o)	-104.7158	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059711	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172517_1042691	F059711	AGGAG	MRTRTLHTPINLLIEPNTYQRLKMIAGLQKTTMSKFIREGIKLRLAQYD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.