Scaffold Ga0136641_1024415

Overview

Basic Information

• Taxon OID: 3300013286
• Scaffold ID: Ga0136641_1024415
• Source Dataset Name: Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1849
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Elizabeth Lake, Yosemite National Park, California, USA
• Coordinates
  • Lat. (^o): 37.8453
  • Long. (^o): -119.3697

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069671	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136641_10244151	F069671	GGAG	MIKFKHEDDTFKRFPRTLMEAFPSAPEWQDKPHLADRIIVYLGCFVAGFLTALIVFS*