Scaffold Ga0136642_1023019

Overview

Basic Information

• Taxon OID: 3300013285
• Scaffold ID: Ga0136642_1023019
• Source Dataset Name: Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1812
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Lower Cathedral Lake, Yosemite National Park, California, USA
• Coordinates
  • Lat. (^o): 37.8453
  • Long. (^o): -119.4233

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031398	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136642_10230194	F031398	AGGAG	MAKVAPQMKASLTTKVPSPANQGGHSSSEAVTQKTKIQPKAGAAKAGASTHVYSKMPSGTRGTNPGAK*