Scaffold Ga0136642_1000129

Overview

Basic Information

• Taxon OID: 3300013285
• Scaffold ID: Ga0136642_1000129
• Source Dataset Name: Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 45400
• Total Scaffold Genes: 93
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 62 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Lower Cathedral Lake, Yosemite National Park, California, USA
• Coordinates
  • Lat. (^o): 37.8453
  • Long. (^o): -119.4233

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095137	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136642_100012933	F095137	N/A	MPTKRTRIYPEKNCLTCGVVFAKQGKYCCRACGNVRTFTPTYKAKISRGVRKKMADDPEHKQKIIAAIQPDIPIPPMTESPVGLNQFISDGDLWTNAD*