Scaffold Ga0172420_10772383

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172420_10772383

Scaffold Ga0172420_10772383

Overview

Basic Information
Taxon OID	3300013233 Open in IMG/M
Scaffold ID	Ga0172420_10772383 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Western Washington University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	718
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mat From Mariana Arc And Backarc, Pacific Ocean

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	12.916667	Long. (^o)	143.633333	Alt. (m)		Depth (m)	2931
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104976	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0172420_107723831	F104976	AGGAGG	MGRARKTLRLILKHVQGVERDCVIKRRKTGWFDKERYLHRIVNNIGRLRQLVVPAYEKNTALAKCWASYLNVQGMDDKNETRDKRRVEFHDVLDYSINRFGSDAVDPPIGEVRAHGRGYAVVNGKSIYVSKLRDTSLRGYYEPERAKRSGKRSLADTDYWAVRTPRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.