| Basic Information | |
|---|---|
| Taxon OID | 3300013233 Open in IMG/M |
| Scaffold ID | Ga0172420_10345447 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Western Washington University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1115 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mat From Mariana Arc And Backarc, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 12.916667 | Long. (o) | 143.633333 | Alt. (m) | Depth (m) | 2931 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007209 | Metagenome | 355 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0172420_103454472 | F007209 | GGAG | MLRYRYTLTKEGLRRCINNEFYLQKTPRYKGYTEKIFRILYHAEKPLTIREISELTGIHKRSVNGVITFNIMAGYIKREFL* |
| ⦗Top⦘ |