Basic Information | |
---|---|
Taxon OID | 3300013232 Open in IMG/M |
Scaffold ID | Ga0170573_10932577 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Davis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 876 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pittsburgh | |||||||
Coordinates | Lat. (o) | 40.44 | Long. (o) | -79.99 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040700 | Metagenome / Metatranscriptome | 161 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0170573_109325771 | F040700 | N/A | SMDQQFLNLLDDVAAGGPDGAGGLMLQTAGGAQKLLFSNGGAAPISGG* |
⦗Top⦘ |