Scaffold Ga0170573_10544785

Overview

Basic Information

• Taxon OID: 3300013232
• Scaffold ID: Ga0170573_10544785
• Source Dataset Name: Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Davis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 624
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium pictum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa

Source Dataset Sampling Location

• Location Name: Pittsburgh
• Coordinates
  • Lat. (^o): 40.44
  • Long. (^o): -79.99

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046195	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170573_105447852	F046195	GGA	MKVSRRWIEWAHGPGAEDGQPLAMSLCDLASAPGAGSIEVADLALIAELVDVAGLYVNPCRGDALHDMGPWWMGQPRRIISEGRASLRAADSAATSPAVDGQPE*