| Basic Information | |
|---|---|
| Taxon OID | 3300013232 Open in IMG/M |
| Scaffold ID | Ga0170573_10458767 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Davis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 945 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pittsburgh | |||||||
| Coordinates | Lat. (o) | 40.44 | Long. (o) | -79.99 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023894 | Metagenome / Metatranscriptome | 208 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170573_104587672 | F023894 | N/A | MKGATMEHSSRLKGQSCWVLGLFVIGVALMLFACDQPSGQQSDLSKKAPPSLGAIADVDGSDDTKKEGKKPQAGAEQTPAQSPAAGQPPQAAPKQ* |
| ⦗Top⦘ |