| Basic Information | |
|---|---|
| Taxon OID | 3300013232 Open in IMG/M |
| Scaffold ID | Ga0170573_10108906 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Davis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3228 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment → Sediment Microbial Communities From Acid Mine Drainage (Amd) Holding Pond In Pittsburgh, Pa, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pittsburgh | |||||||
| Coordinates | Lat. (o) | 40.44 | Long. (o) | -79.99 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026912 | Metagenome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170573_101089066 | F026912 | AGGGGG | MDMKECKPLFSIIDRMIDTSEPLRAEYFRGYHRGLDAQVLGVSDERIEEHSLLIDYSIGGSGDPYIDSYARGYHDGFEGLAPEAPSIPSGSPKQLLIASIV* |
| ⦗Top⦘ |