Basic Information | |
---|---|
Taxon OID | 3300013231 Open in IMG/M |
Scaffold ID | Ga0116832_1063499 Open in IMG/M |
Source Dataset Name | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 593 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Gulf of Mexico | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066735 | Metagenome / Metatranscriptome | 126 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116832_10634991 | F066735 | N/A | DIQEMKMMATIDDIQAYAIATAGLTAGQINNALINAGLETGAGGIDDFDVAGLFGFGADALPGIIGGLPSSYTPRNPADTDFYREGDEYNIFANLPVEDLYGLQARLIQGGLLARGGFTPGDFDSATASAMRLVLGRQNRIGVKSGEKDIAWNESLLLYQNEPLPSGEEVSVFLPPDYAEVSTSIRNLFTENLGRLA |
⦗Top⦘ |