Scaffold Ga0116832_1058626

Overview

Basic Information

• Taxon OID: 3300013231
• Scaffold ID: Ga0116832_1058626
• Source Dataset Name: Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 610
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa

Source Dataset Sampling Location

• Location Name: USA: Gulf of Mexico
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022875	Metagenome	212	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116832_10586263	F022875	N/A	MKTKLNLTDDIKENIRVRAKAHINSTDPEPDHWDSIETSDGFVDFNVWKDDDYRGGEWIVTCYDTYHSTDDGCVHTDTSTFKRIAL*